8-Letter Words Starting With H
982 8-letter words start with the letter H, including happened, hospital, honestly, hundreds. Every word below is valid in Scrabble-style word games.
Highest scoring
- huzzahed33
- hazzanim31
- huzzaing30
- hizzoner29
- highjack28
- hokypoky27
- hexarchy26
- hemolyze25
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list982
habanerahabdalahhabitanshabitanthabitatshabitinghabitualhabitudehabitueshachuredhachureshaciendahackbutshacklershacklierhacklinghackneyshacksawshackworkhaddockshadronichaematalhaematichaematinhaeredeshafniumshaftarahhaftarashaftarothaftorahhaftorothagadisthagberryhaggadahhaggadashaggadichaggadothaggardshaggiseshagglershagglinghagrideshahniumshairballhairbandhaircapshaircutshairiesthairlesshairlikehairlinehairlockhairnetshairpinshairworkhairwormhalachashalachothalakahshalakhashalakhothalakisthalakothhalalahshalationhalavahshalazonehalberdshalbertshalcyonshalenesshalfbackhalfbeakhalflifehalfnesshalftimehalftonehalibutshalidomehalidomshalliardhallmarkhalloaedhalloinghallooedhallowedhallowerhalluceshallwayshalogenshalolikehalteredhaltereshaltlesshalutzimhalyardshamartiahambonedhamboneshamburgshammadashammeredhammererhammiesthammockshamperedhampererhamstershamulatehamulosehamuloushanapershandbagshandballhandbellhandbillhandbookhandcarshandcarthandcuffhandfasthandfulshandgriphandgunshandheldhandholdhandicaphandiesthandlershandlesshandlikehandlinghandlisthandloomhandmadehandmaidhandoffshandoutshandoverhandpickhandrailhandsawshandselshandsetshandsewnhandsfulhandsomehandworkhandwrithandymanhandymenhangablehangaredhangbirdhangdogshangfirehangingshangnailhangnesthangoutshangoverhangtagshankeredhankererhanseledhanumanshaphtarahapliteshaploidshaploidyhaplontshaplopiahaploseshaplosishappenedhappiesthapteneshaptenichapticalharangueharassedharasserharassesharboredharborerharbourshardbackhardballhardboothardcasehardcorehardedgehardenedhardenerhardhackhardhatshardheadhardiesthardlinehardnesshardnosehardpanshardshiphardtackhardtopshardwarehardwirehardwoodharebellharelikeharelipsharianasharicotsharijansharkenedharkenerharlotryharminesharmlessharmonicharpingsharpistsharpoonsharridanharriersharrowedharrowerharrumphharryingharshensharshestharsletsharumphsharuspexharvestshasheeshhashheadhasslinghassockshastefulhastenedhastenerhastiesthatbandshatboxeshatcheckhatchelshatchershatcheryhatchetshatchinghatchwayhateablehatmakerhatrackshatteriahauberkshaulageshauliershaulmierhaulyardhaunchedhauncheshauntershauntinghausfrauhautboishautboyshauteurshavartishavdalahhavelockhaveninghaverelshaveringhaviourshavockedhavockerhawfinchhawkbillhawkeyedhawkingshawklikehawkmothhawknosehawkshawhawkweedhawthornhaycockshayfieldhayforkshaylageshayloftshaymakerhayrackshayrickshayrideshayseedshaystackhaywardshaywireshazardedhazelhenhazelnuthazinesshazzanimheadacheheadachyheadbandheadfishheadgateheadgearheadhuntheadiestheadingsheadlampheadlandheadlessheadlineheadlockheadlongheadmostheadnoteheadpinsheadraceheadrestheadroomheadsailheadsetsheadshipheadsmanheadsmenheadstayheadwaysheadwindheadwordheadworkhealablehearablehearingshearkenshearsayshearsingheartensheartierheartiesheartilyheartingheatableheatedlyheathensheathersheatheryheathierheatlessheavenlyheaviestheavysethebdomadhebetatehebetudehebraizehecatombhecklershecklinghectareshecticalhecticlyhectoredhedgehoghedgehophedgepighedgerowhedgiesthedonicshedonismhedonistheedlessheehawedheelballheelingsheellessheelpostheeltapsheftiesthegemonyhegumenehegumenshegumenyheightenheighthsheirdomsheirlessheirloomheirshipheistersheistinghektaresheliacalheliastshelicityhelicoidheliconshelicopthelilifthelipadsheliporthelistophellbenthellcatshellfirehellholehellionshellkitehelloinghelmetedhelminthhelmlesshelmsmanhelmsmenhelotagehelotismhelpablehelpingshelplesshelpmatehelpmeethemagogshemateinhematicshematinehematinshematitehematoidhematomahemiolashemioliahemipterhemlineshemlockshemocoelhemocytehemolyzehemostathempiesthemplikehempseedhempweedhenbaneshenchmanhenchmenhencoopshenequenhenequinhenhouseheniquenhennainghenpecksheparinshepaticahepaticshepatizehepatomaheptagonheptanesheptarchheptosesheraldedheraldicheraldryherbagesherbariaherbiestherblessherblikeherculesherdlikeherdsmanherdsmenhereawayheredityhereintoheresieshereticsheretrixhereuntohereuponherewithheritageheritorsheritrixhermaeanhermetichermitichermitryherniateheroicalheroinesheroismsheroizedheroizesherpeticherringsherryingherstoryhesitanthesitatehessianshessiteshetaeraehetaerashetaerichetairaihetairashexagonshexagramhexaminehexaplarhexaplashexapodshexapodyhexarchyhexereishexosanshiatuseshibachishibernalhibiscushiccoughhiccupedhidalgoshiddenlyhideawayhidelesshideoutshidroseshidrosishidrotichierarchhieratichigglershigglinghighballhighbornhighboyshighbredhighbrowhighbushhighjackhighlandhighlifehighnesshighroadhighspothightailhightinghighwayshijackedhijackerhilarityhildingshilliesthilloaedhillockshillockyhilloinghillsidehilltopshiltlesshimationhinderedhindererhindgutshindmosthinnyinghipboneshiplineshipparchhippiesthipstershiraganahireablehirelinghirplinghirseledhirslinghirudinshissingshistaminhistidinhistogenhistoneshistorichitchershitchinghithertohivelesshizzonerhoactzinhoardershoardinghoariesthoarselyhoarsenshoarsesthoatzinshobblershobblinghobbyisthobnailshoboismshockshophocusinghocussedhocusseshoecakeshoedownshogbackshogmanayhogmaneshogmenayhognoseshogsheadhogtyinghogweedshoickinghoidenedhoistershoistinghokinesshokypokyholdableholdallsholdbackholdfastholdingsholdoutsholdoverholelessholibutsholidaysholinessholistichollainghollandsholleredholloaedholloinghollooedhollowedhollowerhollowlyholmiumshologamyhologramhologynyholotypeholozoicholsteinholstersholydaysholytidehomagershomaginghomburgshomebodyhomeboyshomebredhomelandhomelesshomelierhomelikehomemadehomeoboxhomeotichomeporthomeringhomeroomhomesickhomesitehomespunhomestayhometownhomewardhomeworkhomicidehomilieshomilisthominesshominianhominidshominieshomininehominizehominoidhommockshommoseshomogamyhomogenyhomogonyhomologshomologyhomonymshomonymyhonchoedhondlinghonesterhonestlyhoneworthoneybeehoneybunhoneydewhoneyfulhoneyinghonorandhonoraryhonoreeshonorershonoringhonouredhonourerhoodiesthoodlesshoodlikehoodlumshoodooedhoodwinkhoofbeathooflesshooflikehookiesthooklesshookletshooklikehooknosehookwormhooliganhooplesshooplikehoopsterhoorahedhoorayedhoosegowhoosgowshootcheshootiesthopefulshopelesshopheadshopliteshoplitichoppiesthoppingshopplinghopsackshoptoadshordeinshorizonshormonalhormoneshormonichornbeamhornbillhornbookhornfelshorniesthornistshornitoshornlesshornlikehornpipehornpouthorntailhornwormhornworthorologehorologyhorriblehorriblyhorridlyhorrifichorsecarhorseflyhorsemanhorsemenhorsepoxhorsiesthosannahhosannashosepipehospiceshospitalhospitiahospodarhostageshosteledhostelerhostelryhostileshostlershotbloodhotboxeshotcakeshotchinghotchpothoteldomhotelierhotelmanhotelmenhotfootshotheadshothousehotlineshotpresshotshotshotspurshoundershoundinghouseboyhouseflyhousefulhouseledhousemanhousemenhousesathousesithousetophousingshovelinghovelledhoverershoveringhowdyinghowitzerhoydenedhuarachehuarachohubriseshucksterhuddlershuddlinghuffiesthugenesshuggablehuipileshuisachehulkiesthulloaedhulloinghumanelyhumanesthumanisehumanismhumanisthumanityhumanizehumanoidhumblershumblesthumblinghumdrumshumeralshumidifyhumidityhumidorshumifiedhumilityhummablehummockshummockyhummuseshumorfulhumoringhumoristhumoroushumouredhumpbackhumphinghumpiesthumplesshunchinghundredshungeredhungoverhungrierhungrilyhunkeredhunkiesthuntablehuntedlyhuntingshuntresshuntsmanhuntsmenhurdlershurdlinghurlingshurrahedhurrayedhurriershurryinghurtlesshurtlinghusbandshushedlyhuskiesthuskingshusklikehustingshustlershustlinghuswifeshuswiveshutchinghutmentshutzpahshuzzahedhuzzainghyacinthhyalineshyaliteshyalogenhyaloidshybriseshydatidshydracidhydragoghydranthhydrantshydraseshydratedhydrateshydratorhydrideshydrogelhydrogenhydroidshydromelhydronichydropichydropsyhydroskihydrosolhydroxylhygeistshygieisthygieneshygienichylozoichymenealhymenialhymeniumhymnbookhymnistshymnlesshymnlikehyoideanhyoscinehypergolhyperonshyperopehyphemiahyphenedhypnoseshypnosishypnotichypoacidhypodermhypogealhypogeanhypogenehypogeumhypogynyhyponeashyponoiahypopneahypopyonhypothechypoxiashyracoidhysteriahysteric