7-Letter Words Starting With L
809 7-letter words start with the letter L, including looking, limited, leading, leaving. Every word below is valid in Scrabble-style word games.
Highest scoring
- lezzies25
- lockjaw23
- lazyish22
- liquefy22
- liquify22
- lockbox22
- lacquey21
- lazying20
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list809
laagerslabarumlabeledlabelerlabellalabialslabiatelaboredlaborerlabourslabretslabroidlabrumslaciestlacingslackerslackeyslackinglaconiclacquerlacqueylactamslactarylactaselactatelacteallacteanlactonelactoselacunaelacunallacunarlacunaslacunesladanumladdersladdiesladenedladingsladinosladlersladlingladroneladronsladybugladyishladykinlagendslageredlaggardlaggerslagginglagoonslagunaslaguneslaiciselaicismlaicizelairdlylairinglaithlylaitieslakiestlakingslallandlallanslallinglambastlambdaslambentlamberslambertlambierlambieslambinglambkinlamedhslamellalamentslaminaelaminallaminarlaminaslamminglampadslamperslampinglampionlampoonlampreylamsterlanatedlancerslancetslancinglandauslanderslandinglandlerlandmanlandmenlanewaylangleylangrellangueslanguetlanguidlanguorlangurslaniardlaniarylanitallankestlankierlankilylannerslanolinlantanalanternlanugoslanyardlapdogslapeledlapfulslapideslapillilapiseslapperslappetslappinglapserslapsinglaptopslapwinglarcenylarcheslarderslardierlardinglardonslardoonlargelylargesslargestlargishlariatslarkerslarkierlarkinglarkishlarrupslasagnalasagnelascarslasherslashinglashinslashkarlassieslassoedlassoerlassoeslasterslastinglatakialatchedlatcheslatchetlateenslatencylatenedlatentslateradlaterallatestslatexeslatherslatherylathierlathinglaticeslatigoslatinoslatosollatriaslatrinelattenslatticelattinslauderslaudinglaughedlaugherlaunceslaunderlaundrylaurelslauwinelavaboslavageslaveerslavrocklawbooklawineslawingslawlesslawlikelawsuitlawyerslaxnesslayawaylayeredlayettelayoffslayoutslayoverlazaretlaziestlazulislazyinglazyishleachedleacherleachesleadersleadierleadingleadmanleadmenleadoffleafageleafierleafingleafletleaguedleaguerleaguesleakageleakersleakierleakilyleakingleanersleanestleaningleapersleapinglearierlearnedlearnerleasersleashedleashesleasingleatherleavensleaversleavierleavinglecherslecherylechinglechweslecternlectinslectionlectorslecturelecythiledgersledgierleechedleechesleerierleerilyleeringleewardleewaysleftestleftiesleftishleftismleftistlegallylegatedlegateelegateslegatorlegatoslegendsleggierlegginglegginsleghornlegiblelegiblylegionslegistsleglessleglikelegongslegroomlegumesleguminlegworklehayimleisterleisurelekvarslekythilemmatalemminglempiralemureslenderslendinglengthslengthylenientlensinglensmanlensmenlentigolentilslentisklentoidleonineleopardleotardleporidleproseleprosyleprousleptonslesbianlesionslesseeslessenslessonslessorsletchedletchesletdownlethalsletheanletterslettinglettuceleucineleucinsleuciteleucomaleukomaleukonslevantslevatorleveledlevelerlevellyleveredleveretlevierslevulinlevyinglewdestlewiseslexemeslexemiclexicallexiconlezziesliaisedliaisesliaisonlianoidlibberslibeledlibeleelibelerliberallibertylibidosliblabslibrarylibratelicencelicenselicentelicheeslichenslichtedlichtlylicitlylickerslickinglictorsliddinglidlessliefestlierneslievestlifefullifewayliftersliftingliftmanliftmenliftoffligandsligasesligatedligateslightedlightenlighterlightlylignifyligninsligniteligroinligulaeligularligulasligulesligureslikablelikenedlikingsliltinglimaconlimbatelimbecklimberslimbierlimbinglimeadelimiestliminallimitedlimiterlimiteslimmerslimnerslimninglimperslimpestlimpetslimpinglimpkinlimpseylimuluslinablelinageslinalollindanelindenslindieslineagelineatelinecutlinemanlinemenlineupslingamslingcodlingerslingierlingoeslinguaelingualliniestliningslinkagelinkboylinkerslinkinglinkmanlinkmenlinkupslinnetslinocutlinsanglinseedlinseyslintelslinterslintierlintolslinuronlionesslioniselionizelipaseslipideslipidicliplessliplikelipoidslipomaslippenslipperslippierlippingliquateliquefyliqueurliquidsliquifyliquorslisentelisperslispinglissomelisteeslistelslistenslisterslistinglitchisliterallithelylithestlithiaslithifylithiumlithoedlithoidlitorallitoteslitoticlitterslitterylittlerlittlesliturgylivablelivenedlivenerlividlylivierslivingslivyerslixivializardsloachesloadersloadingloafersloafingloamierloamingloanersloaningloathedloatherloathesloathlylobatedlobberslobbiedlobbieslobbinglobbyerlobefinlobelialobsterlobularlobuleslobwormlocaleslocallylocatedlocaterlocateslocatorlochanslochiallockagelockboxlockerslocketslockinglockjawlocknutlockoutlockramlockupslocoinglocoismlocularloculedloculesloculuslocustalocustslodgerslodgingloessalloessesloftersloftierloftilyloftingloganialogbookloggatsloggersloggetsloggiasloggierlogginglogicallogiestlogionslogjamslogrolllogwayslogwoodloiterslollerslollieslollinglollopslomeinslomentalomentslonganslongbowlongerslongestlongieslonginglongishloobiesloofahslookerslookinglookoutlookupsloominglooneysloonierlooniesloopersloopierloopinglooselyloosensloosestloosinglooterslootingloppersloppierloppingloquatslordinglordomalorgnonloricaelorimerlorinerloriseslorrieslosablelosingslotionslotoseslotterylottinglotusesloudensloudestloudishloungedloungerloungesloupinglouringlousierlousilylousingloutingloutishlouverslouvredlouvreslovablelovablylovageslovebugloverlylowballlowbornlowboyslowbredlowbrowlowdownloweredlowingslowlandlowlierlowlifelownessloyalerloyallyloyaltylozengelubberslucarnelucencelucencylucernelucernslucidlyluciferluckierluckiesluckilyluckinglueticsluffinglugeingluggageluggersluggieslugginglugsaillugwormlullabylullinglumbagolumbarslumberslumenalluminallumpenslumperslumpierlumpilylumpinglumpishlunatedlunaticlunchedluncherluncheslunettelunganslungeeslungerslungfullunginglungyisluniestlunkersluntinglunulaelunularlunuleslupanarlupineslupulinlupuseslurchedlurcherlurcheslurdanelurdansluridlylurkerslurkinglushestlushinglusterslustfullustierlustilylustinglustrallustredlustreslustrumlususesluteinsluteousluthernluthierlutingslutistsluxatedluxateslyceumslycheeslychnislycopodlydditelyinglylynceanlynchedlyncherlyncheslyratedlyricallyrismslyristslysateslysineslysogen