Skip to content

Word lists

6-Letter Words Ending in S

4,277 6-letter words end in S, including always, things, states, thanks. All are playable in Scrabble-style games and useful for Wordle endings.

Highest scoring

  • jazzes31
  • fezzes27
  • fizzes27
  • fuzzes27
  • huzzas27
  • bizzes26
  • buzzes26
  • cozzes26

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

Most common first4,277

Showing the 2,000 most common of 4,277 words. The length links below give complete lists.

aaliisabacasabacusabakasabampsabasesabatesabatisabbessabbeysabbotsabelesabhorsabidesablinsabmhosabodesabohmsabomasabortsabovesabusesabysmsacarusaccessacinusackeesacornsacrossactinsactorsacutesadagesadaptsaddersaddlesadeemsadeptsadieusadmassadmitsadobesadobosadonisadoptsadoresadornsadultsaeneusaeriesafritsaftersagamasagatesagavesagenesagentsaggersaggiesaggrosagingsagismsagistsagletsagonesagorasagreesagriasaholdsaidersaimersaiolisairbusairersairthsaislesaiversajivasajugasakelasakenesalamosalandsalantsalarmsalatesalbumsalcidsaldersaldolsalephsalertsalginsalgorsalgumsalibisaliensalignsalinesaliyasaliyosalkiesalkydsalkylsallaysalleesalleysalliesallodsallotsallowsalloysallylsalmahsalmehsalmudsalmugsalohasaloinsalphasaltarsaltersalwaysamazesambersambitsamblesamebasameersamendsamentsamicesamicusamidesamigasamigosaminesamolesamoursampulsamucksamusesanabasanearsanelesangelsangersanglesangstsanimasanimesanimisanimusanionsanisesanklesannalsannoysannulsanodesanolesanticsantresanusesanvilsaortasapexesaphidsapicesapneasappalsappelsapplesapronsarborsarchesardebsardorsarecasarenasaretesargalsargilsarglesargolsargonsargotsarguesarhatsarielsarisesarmersarmetsarmiesarmorsaroidsaromasarpensarraysarrowsarsonsartelsasanasascotsasdicsasidesaskersaspensaspersaspicsassaisassaysassessassetsastersatmansatollsatonesattarsatticsaudadsaudiosauditsaugersaughtsaugursaureusaurousaurumsauxinsavailsavertsaviansavionsavisosavoidsawaitsawakesawardsawlessawmousaxiomsaxionsaxisesaxitesaxonesazidesazinesazlonsazolesazotesazothsazuresazygosbaasesbabelsbabiesbabkasbaboosbabulsbachesbaconsbadassbadgesbagassbagelsbairnsbaizasbaizesbakersbalersbalsasbancosbanjosbarbesbardesbargesbaronsbarresbaryesbashesbasicsbasilsbasinsbassesbassosbastesbathesbathosbatiksbatonsbaulksbayousbazarsbazoosbeanosbeardsbeastsbeautsbebopsbecapsbedelsbedewsbedimsbeevesbefitsbefogsbegetsbeginsbegumsbeigesbeingsbekissbelaysbelgasbeliesbellesbelowsbendysbennesbennisberetsbermesberthsberylsbesetsbesomsbesotsbetelsbetonsbettasbevelsbeviesbevorsbewigsbezelsbezilsbhangsbhootsbialisbialysbiasesbiblesbicepsbidersbidetsbieldsbightsbigotsbijousbikersbikiesbilbosbilgesbimahsbimbosbindisbingesbingosbinitsbinocsbiogasbiomesbiontsbiotasbipedsbipodsbirlesbirsesbirthsbisonsbitersbizzesblacksbladesblainsblamesblanksblaresblastsblazesbleaksblearsbleatsbleedsbleepsblendsblimpsblindsblinisblinksblitesbloatsblocksblokesblondsbloodsbloomsbloopsbluetsblueysbluffsblumesbluntsblurbsblurtsblypesboardsboartsboastsboccesboccisbochesbodiesboffosbogansbogeysbogiesboglesboheasboitesbombesbonersbongosbonnesbonzesboostsboothsboozesboralsborersboronsboshesbosomsbosonsbossesbosunsbotelsboughsboulesboundsbourgsbournsbousesbovidsbowelsbowersbowsesboxersboyarsboylasbracesbrachsbractsbraidsbrailsbrainsbrakesbrandsbranksbrantsbravasbravesbravosbrawlsbrawnsbrazasbrazesbreadsbreaksbreamsbredesbreedsbreeksbrentsbrevesbrewisbriarsbribesbricksbridesbriefsbriersbrillsbrinesbringsbrinksbrisksbrittsbroadsbrocksbroilsbromesbromosbroncsbroodsbrooksbroomsbrosesbrothsbrownsbrughsbruinsbruitsbrumesbruntsbrutesbubalsbuboesbudgesbuffosbuglesbuildsbulgesbumphsbuncosbundtsbunkosbunyasburansburetsburghsburiesburinsburkesburrosbursasbursesburstsbushesbusiesbussesbuteosbutlesbuttesbututsbutylsbuyersbuzzesbwanasbylawsbypassbyssusbywayscabalscaberscabinscablescabobscacaoscachescactuscaddiscadetscadgescadrescagerscahowscairdscairnscalcescalifscallascalluscalvescalxescamasscamelscameoscamposcampuscanalscanerscanidscannascanoescanonscansoscantoscantuscanvascaperscapiascaponscapriscaratscarboscarerscaresscaretscargoscariescarlescarobscarolscaromscarpuscarsescartescarvescashescassiscastescaterscaucuscauldscaulescauliscaulkscausescaverscaviescavilsceasescebidscedarscedersceibascelebscelloscelomscensescensuscentosceorlscerciscercuscereusceriascerouscertescessescestascestoscestuschafeschaffschainschairschalkschampschangschantschapescharaschardscharescharkscharmscharrschartschaseschasmscheapscheatscheckscheekscheepscheerschelaschemoschertschestschethschiauschickschicoschideschiefschielschileschillschimbschimeschimpschinaschineschinkschinoschintschirkschirmschiroschirpschirrschiveschockschoirschokescholoschompschookschordschoreschoruschoseschottschuckschufaschuffschumpschunkschurlschurnschurrschuteschyleschymescibolsciderscigarscircuscirrusciscoscistusciterscitiescitruscivetscivicsciviesclachsclackscladesclaimsclampsclangsclanksclarosclaspsclastsclavesclavuscleansclearscleatscleekscleftsclepesclerksclevisclickscliffscliftsclimbsclimesclinesclingsclinkscloaksclocksclompsclonesclonksclonusclootsclosesclothscloudsclourscloutsclovesclownsclozesclucksclumpsclunkscoactscoalascoaptscoastscoatiscoaxescobiascoblescobrascoccuscocoascodecscodenscoderscodonscogonscohogscoignscoituscoleuscolicscoliescolinscologscolonscolorscolzascombescomboscomerscometscomicscommascomouscomposcomptscomtesconchscondosconeyscongascongescongosconicsconiesconinscontescontoscooeescooerscooeyscoombscooptscopalscopenscoperscopiescoprascopsescoralscorerscorgiscornuscorpuscorsescorvescosecscosetscoseyscoshescosiescosmoscotanscottascoughscouliscountscoupescourtscouthscovenscoverscovetscoveyscovinscowerscoypuscozenscozeyscoziescozzescraalscrackscraftscrakescrampscranescrankscrapescrasescrasiscratescravescrawlscrazescreakscreamscredoscreedscreekscreelscreepscremescrepescrestscrickscrierscrimescrimpscripescrisescrisiscrispscroakscrockscrocuscroftscronescrookscroonscrorescroupscrowdscrownscrozescrucescruckscrudescruetscrumbscrumpscruorscrusescrustscruxescrwthscryptscubebscuberscubicscubitsculetsculliscultuscuminscupelscupidscuppascurerscuretscuriescurioscursescurvescuscuscusecscuspiscussescussoscustoscuteyscutiescutinscutlascutupscycadscyclescycloscyderscyesescyesiscymarscymolscymouscynicscyprescypruscytonsdachasdadoesdaggasdagoesdaisesdallesdamansdamarsdancesdaniosdarersdaricsdashesdashisdatersdattosdatumsdaubesdauntsdavensdaviesdavitsdeairsdeathsdeavesdebarsdebitsdebrisdebugsdebutsdebyesdecafsdecalsdecaysdecorsdecoysdedansdefatsdefersdefiesdefogsdegumsdeicesdeignsdeismsdeistsdeixisdekkosdelaysdelftsdeltasdelvesdemiesdemitsdemobsdemonsdemursdeniesdenimsdepotsdepthsderatsderaysdermasdermisderrisdetersdeucesdevelsdevilsdevonsdewansdewarsdexiesdhobisdholesdhotisdhutisdicersdicotsdidiesdidoesdienesdiesesdiesisdightsdigitsdikersdildosdimersdinarsdinersdingesdingusdiodesdipsasdipsosdirgesdiscosdiscusdishesdismesdissesdittosditzesdivansdiversdivotsdiwansdixitsdizensdjinnsdobiesdoblasdobrasdodgesdodoesdogeysdogiesdogmasdoingsdolmasdolorsdoneesdongasdonnasdonorsdonutsdoofusdopersdoriesdosersdossesdotersdoubtsdoughsdoumasdourasdousesdovensdowelsdowersdowsesdoxiesdoyensdozensdozersdraffsdraftsdrailsdrainsdrakesdramasdrapesdrawlsdreadsdreamsdrearsdrecksdriersdriftsdrillsdrinksdrivesdroitsdrollsdronesdroolsdroopsdrouksdrovesdrownsdruidsdrunksdrupesdrusesdryadsdryersducatsduliasdulsesdunamsduncesduomosdupersduressdurocsdurrasdurumsdutiesduvetsdwarfsdweebsdwellsdwinesdyingsdynelseagerseagleseagresearthseaselseasieseatersebbetsecesisechoeseclatseddieseddoesedemasedgersedictsedileseduceseductsegestseggarseggersegisesegressegretseiderseightseikonsejectselainselandselateselbowselderselectselemiselfinselideselintseliteseloinselopeseludeseluteselversembarsembaysembedsembersembossembowsemceesemeersemendsemesesemesisemmersemmetsemotesemydesenactsenatesendersendowsenduesenemasenjoysennuisenokisenosisenrolsensuesentersenuresenviesenvoisenvoysenzymseosinsepactsephahsephodsephorsepochsepodeseposesequalsequidsequipseraseserectsergotsericaserodeseroseserrorseructserugoseruptservilsescarsescotseskarseskersespiesessaysestersestopsestrusetapesetchesethersethicsethnosethylsetudesetweesevadeseventsevertsevictsevitesevokesexactsexaltsexcelsexcessexertsexilesexinesexistsexodosexodusexpatsexpelsextolsextrasexudesexultsexurbseyaseseyriesfablesfacersfacetsfaciasfaciesfadersfadgesfaecesfaenasfaginsfagotsfaintsfaithsfakersfakirsfalcesfamousfangasfanonsfanumsfaqirsfaradsfarcesfarersfarlesfascesfashesfatsosfatwasfaucesfauldsfaultsfaunasfauvesfavorsfeasesfeastsfeazesfeezesfeignsfeintsfeistsfelidsfellasfelonsfemmesfemursfencesfeoffsferiasfermisfessesfetorsfeuarsfeversfezzesfibersfibresfichesfichusficinsficoesfidgesfieldsfiendsfifersfifthsfightsfilersfiletsfillesfillosfilthsfinalsfiordsfiquesfirersfirstsfirthsfishesfiversfixersfizzesfjeldsfjordsflacksflailsflairsflakesflamesflanesflanksflaresflasksflatusflaxesfleamsflecksfleersfleetsflexesflicksfliersflingsflintsflirtsflitesfloatsflocksflongsfloodsfloorsflorasflotasfloursfloutsfluffsfluidsflukesflumesflumpsflunksfluorsflutesfluxesfluytsflybysflyersflytesfoehnsfoetusfogeysfogiesfoistsfoliosfollesfollisfondusforamsforaysforcesforgesformesfortesfortisforumsfossasfossesfoundsfountsfoveasfoyersfracasfrailsframesfrancsfranksfraudsfreaksfreersfreresfriarsfriersfrillsfrisesfrisksfrithsfrittsfrizesfrocksfrondsfrontsfrostsfrothsfrownsfruitsfrumpsfryersfucousfudgesfugiosfuglesfuguesfumersfumetsfundusfungusfuransfuriesfurorsfurzesfuseesfuselsfusilsfussesfutonsfutzesfuzeesfuzilsfuzzesgamersgatorsgaugesgeniusgenresghostsgiantsglandsglobesglovesgracesgradesgrainsgrantsgrapesgraphsgravesgreatsgreensgreetsgrimesgroupsgrovesguardsguestsguidesguildshabitshalvesharasshatershauntshavensheartshedgesheroesherpeshiatushikershingeshomershonorshordeshorseshotelshoundshouseshumanshummusidealsidiotsimagesinchesindiesinputsissuesjewelsjointsjoyousjudgesjuicesjuriesjurorskissesknivesknockslabelsladieslakerslaserslasheslaughslayerslearnsleasesleaveslemonslenseslevelsleverslevieslightslilieslimitslinerslipidsliterslitreslocalslodgesloserslossesloverslowerslyricsmadrasmajorsmakersmantismasonsmassesmayorsmedalsmedicsmeritsmessesmetalsmetersmetresmimicsminersminorsmissesmixersmodelsmoniesmonthsmoralsmoronsmorrismotifsmotorsmoundsmountsmouthsmoversmoviesmuralsnervesnichesniecesnightsninjasnoblesnoisesnomadsnovelsnursesoccursoceansoculusoffersoilersoldiesolivesonionsoperasopticsorbitsordersorgansothersottersouncesownerspacerspadrespaganspaintspandaspanelspaperspassespausespayerspearlspedalspelvisperilspetalspetersphasesphonesphotospianospiecespilotspissespixelspizzasplacesplainsplanesplanksplantsplatespleadspointsponiesporouspoundspowerspranksprawnspricespricksprintsprizesprobespromosproofsprovespsalmspulsespupilspursespushesqueensquestsqueuesquirksquotasquotesrabbisrabiesracersradiosradiusraisesrangesrapidsratiosravensreactsrealmsrebelsrecessreevesrefersreignsrelaysrelicsreliesrhinosrhymesrichesridersridgesriflesrightsrivalsriversrobinsrobotsrogersroguesromansroundsroutesroversroyalsrublesrulersrumorsrupeesrushessabressaintssaladssalonssantossaucessaversscalesscaresscenesscentsscoopsscoresscoutsscrapsscrewsscrubsselvessensessepsisseriesservessevenssewersshadesshaftsshakesshanksshapesshardssharessharkssheetsshellsshiftsshinesshirtsshoalsshocksshootsshoresshortsshoutsshredsshrubsshrugssightssirensskatesskiersskillsskirtsskullsslavessleepsslicesslidesslopessmackssmellssmilessmithssmokessnackssnailssnakessneakssolidssolvessoundsspacesspadessparessparksspasmsspeaksspearsspeedsspellsspendsspicesspikesspillsspinessplitsspoilsspoonssporessportssprayssquadssquatsstacksstaffsstagesstainsstairsstakesstalksstallsstampsstandsstaresstartsstasisstatesstatussteaksstealssticksstilesstillsstingsstinksstocksstokesstonesstoolsstoresstormsstovesstrapsstrawsstressstripsstuffsstumpsstuntsstylesstylussugarssuitessurgesswampsswearssweatsswedessweepssweetsswellsswingsswordssynthstablestakerstastestauntstenetstennistenthsthankstheirsthemestheresthesesthesisthighsthingsthinksthirdsthornsthreesthrowsthumbstigerstightstimerstitanstitlestodaystokenstonnestopicstoriestotalstowelstowerstoxinstracestrackstractstradestrailstrainstraitstreatstrendstrialstribestrickstrollstroopstropestruckstrumpstrunkstruststruthstumorstutorstweakstweetstwistsulcersunclesunionsunitesunlessupsetsuterusvaluesvalvesvariesvaultsvegansvenuesversesversusvideosvillasvisitsvocalsvoicesvotersvowelswagonswalruswasheswasteswatersweaveswedgesweighswhaleswheelswhiteswhoopswhoreswidowswisheswolvesworldswoundswreckswristswriteswrongsyachtsyieldsyouths