5-Letter Words
There are 8,636 5-letter words in the public-domain ENABLE word list, including common ones like about, their, there, which. Browse by starting letter below, or jump straight to the full list.
Highest scoring
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
Most common first8,636
Showing the 2,000 most common of 8,636 words. The length links below give complete lists.
abbasabbeyabbotabideaboutaboveabuseabyssacidsacresactedactoracuteadaptaddedadmitadobeadoptadoreadultafteragainagentagileagingagonyagreeaheadaidedaidesaimedairedaislealarmalbumalertalgaealiasalienalignalikealivealleyallowalloyalonealongaloudalphaaltaralteramberamendaminoamongampleangelangerangleangryanimeankleannexannoyapartappleapplyapronarborareasarenaarguearielarisearmedarmorarosearrayarrowarsonashesasideaskedaspenassesassetatlasatomsatticaudioauditavailavantavoidawaitawakeawardawareawfulbabesbacksbaconbadgebadlybakedbakerballsbandsbangsbanksbargebaronbasalbasedbasesbasicbasilbasinbasisbatchbatesbathsbatonbeachbeadsbeamsbeansbeardbearsbeastbeatsbeersbeganbeginbegunbeingbellebellsbellybelowbeltsbenchbennyberryberthbiblebikerbikesbillsbillybindsbingebingobirchbirdsbirthbitchbitesblackbladeblameblandblankblastblazebleakbleedblendblessblindblinkblissblitzblockblokeblondbloodbloomblownblowsbluesbluffbluntblushboardboastboatsbobbybogusboltsbombsbondsbonesbonusboobsbooksboostboothbootsbootyboozeboredborneboundbowelbowlsboxerboxesbracebrainbrakebrandbrassbravebravobrawlbreadbreakbreedbrentbribebrickbridebriefbringbrinkbritsbroadbrockbrokebrookbroombrothbrownbrushbrutebucksbuddybuffybuildbuiltbulbsbullsbullybumpsbunchbunnyburkeburnsburntburstbusesbutchbuttsbuyercabincablecachecagescakescalifcallscamelcameocampscanalcandycanoecanoncarbscardscaredcarescargocarolcarrycartscarvecasescastecastscatchcatercausecavesceasecedarcellscentschainchairchalkchampchangchantchaoscharmchartchasechatscheapcheatcheckcheekcheerchefschesschestchevychickchiefchildchilechilichillchinachipschoirchokechopschordchosechuckchunkcidercigarcircaciscocitedcitesciviccivilclaimclampclansclashclassclawscleanclearclerkclickcliffclimbclingclipscloakclockclonecloseclothcloudclownclubscluescoachcoastcoatscobracockscockycocoacodedcodescoilscoinscolincoloncolorcoltscombocomescometcomfycomiccondoconescongocookscoralcorescorpscostacostscouchcoughcouldcountcourtcovercrabscrackcraftcranecrankcrashcratecravecrawlcrazycreamcreedcreekcreepcrestcrewscriedcriescrimecrispcrookcropscrorecrosscrowdcrowncrowscrudecruelcrushcrustcubescubiccuredcurlscurlycurrycursecurvecycledaddydailydairydaisydancedareddartsdateddatesdealsdealtdeathdebitdebtsdebutdecaydecksdecordeedsdeitydelaydeltademondemosdenimdensedepotdepthderbydesksdeterdevildevondiarydicksdietsdigitdildodinerdirtydiscodiscsdisksditchdittodiverdizzydocksdodgedoingdollsdollydonnadonordoorsdosesdoubtdoughdownsdozendraftdraindrakedramadrankdrawndrawsdreaddreamdressdrieddriftdrilldrinkdrivedronedropsdrovedrowndrugsdrumsdrunkdryerducksdudesdummydunesdustydutchdwarfdwelldyingeagereagleearlyearnseartheateneateredgededgeseditseightelbowelderelecteliteelvesemptyenactendedenemyenjoyenterentryenvoyequalequiperaseerectericaerroressayetherethiceurosevadeeventeveryexactexamsexcelexertexileexistexitsextrafacedfacesfactsfadedfadesfailsfaintfairsfairyfaithfallsfalsefamedfancyfannyfaresfarmsfatalfattyfaultfaunafavorfearsfeastfeedsfeelsfellafenceferryfetalfetchfetusfeverfewerfiberfibrefieldfieryfifthfiftyfightfiledfilesfillsfilmsfilthfinalfinchfindsfinedfinerfinesfiredfiresfirmsfirstfistsfixedfixesflagsflairflameflankflareflashflatsflawsfleetfleshflickfliesflintflirtfloatflockfloodfloorfloraflourflownflowsfluidflushfluteflyerfocalfocusfoldsfolksfoodsfoolsforceforgeforksformsforthfortyforumfoundfoxesframefrankfraudfreakfreedfreshfriedfriesfritzfrogsfrontfrostfrozefruitfucksfuelsfullyfundsfungifunkyfunnyfurryfusedfuzzygainsgamergamesgammagangsgasesgatesgaugegearsgenesgeniegenregenusgermsghostgiantgiftsgimmegirlsgivengivesglandglareglassglobegloryglossglovegluedgoalsgoatsgoinggoodsgoofygoosegorgegrabsgracegradegraftgrailgraingramsgrandgrantgrapegraphgraspgrassgravegravygreatgreedgreekgreengreetgriefgrillgrindgripsgroomgrossgroupgrovegrowngrowsguardguessguestguideguildguiltguisegypsyhabithackshairshairyhallshandshandyhangshappyhardyharryharshhastehatchhatedhateshaunthavenhavochawkshazelheadsheardhearsheartheathheatsheavyhedgeheelsheftyheirsheisthellohelpshencehenryherbshickshideshighshillshintshiredhireshitchhobbyhoganholdsholeshollyhomerhomeshondahoneyhonorhookshoopshopedhopeshornshornyhorsehostshotelhoundhourshousehubbyhumanhumidhumorhurryhurtshydrohypedhypericingiconsidealideasidiotidolsimageimplyindexindieinletinnerinputinterintroironyislesissueitemsivoryjacksjapanjeansjellyjennyjerryjessejeweljihadjimmyjohnsjoinsjointjokerjokesjollyjonesjudasjudgejuicejuicyjumbojumpskappakarmakeepskellykerrykickskillskindskingskinkykittykneesknifeknockknotsknownknowskraftkudoslabellaborlacksladenlakeslampslancelandslaneslapselargelaserlastslaterlatexlaughlauralayerleadsleafsleaksleapslearnleaseleashleastleaveledgelegallegitlemonlendsleonelevelleverlevinlewisliarsliftslightlikedlikeslimbslimitlinedlinenlinerlineslinkslionslistsliterlitrelivedliverlivesloadsloanslobbylocallockslodgeloganlogiclogoslooksloopslooselordsloserloseslotuslouielouislovedloverloveslowerloyalluckylunarlunchlungslyinglynchlyricmacromadammafiamagicmailsmainsmajormakermakesmalesmallsmangomaniamanlymanormaplemarchmariamarksmarrymarshmasksmasonmatchmatermatesmathsmattemaximmaybemayormealsmeansmeantmeatsmeccamedalmediamedicmeetsmeltsmenusmercymergemeritmerrymessymetalmetermetremetromicromidstmightmilesmilkymillsmimicmindsminedminerminesminorminusmistymixedmixermixesmodelmodemmodesmoistmollymommamommymoneymonksmontemonthmoodsmoodymoonsmoosemoralmoronmorsemotelmotifmotormottomouldmoundmountmournmousemouthmovedmovesmoviemuddymummymuralmusicmutedmythsnailsnaivenakednamednamesnancynannynasalnastynatalnavalnazisnecksneedsneedynerdsnervenestsnevernewernewlynexusnicernicheniecenightninjaninthnoblenodesnoisenoisynormsnorthnosesnotchnotednotesnovelnursenylonoasisobeseoccuroceanoddlyofferoftenolderoliveomegaoniononsetopensoperaopiumoptedopticorbitorderorganotherotteroughtounceouteroversowingownedowneroxideozonepacedpackspaddypaganpagespainspaintpairspalmspandapanelpanicpantspapalpaperparisparksparrypartspartypastapastepatchpathspatiopattypausepavedpeacepeachpeakspearlpedalpedropeerspenalpencepenispennyperilperksperrypestspeterpettyphasephonephotopianopickspiecepierspiledpilespillspilotpinchpinespinkypiperpipespitchpivotpixelpizzaplaceplainplaneplankplansplantplateplaysplazapleadpleasplotsplugspoemspoetspointpokerpolarpolespollspondspoolspoppyporchporespornoportsposedposespostspouchpoundpowerprankpresspriceprickprideprimeprintpriorprismprivyprizeprobepromoproneproofpropsproseproudproveproxypsalmpsychpullspulsepumpspunchpupilpuppypurgepursepussyquakequasiqueenqueerqueryquestqueuequickquietquitequitsquotaquoterabbiracedracerracesracksradarradioraidsrailsrainsrainyraiserallyralphranchrandyrangeranksrapedrapesrapidratedratesratioravenrazorreachreactreadsreadyrealmrebelrecapreefsreferrehabreignrelaxrelayrelicremixrenalrenewrentsrepayreplyresetresinrestsretroreuserhinorhymeriderridesridgeriflerightrigidrileyringsrinseriotsrisenrisesrisksriskyritesrivalriverroachroadsroastrobesrobinrobotrocksrockyrodeorogerroguerolesrollsromanromeoroofsroomsrootsropesrosesrotorrougeroughroundrouteroverroyalrugbyruinsruledrulerrulesrumorruralrustysackssadlysafersailssaintsaladsalessallysalonsalsasaltssaltysandssandysantosatinsaucesavedsavessavvyscalescalpscamsscansscarescarfscarsscaryscenescentscoopscopescorescotsscoutscrapscrewscrubsealssearsseatssedanseedsseeksseemsseizesellssemensendssenseserumservesetupsevensewersexesshackshadeshadyshaftshakeshakyshaleshallshameshapesharesharksharpshaveshawnshearshedssheepsheersheetshelfshellshiftshineshinyshipsshireshirtshitsshockshoesshookshootshopsshoreshortshotsshoutshoveshownshowsshutssidedsidessiegesighssightsigmasignssillysilvasincesingssinkssirensitessixthsixtysizedsizesskateskiesskillskinsskirtskullslackslainslamsslangslashslateslavesleepsleptsliceslickslideslimeslipsslopeslotsslowssmacksmallsmartsmashsmearsmellsmilesmithsmokesnacksnailsnakesnapssneaksniffsnoopsnowysobersockssoilssolarsolidsolvesongssonicsonnysorrysortssoulssoundsouthspacespanssparesparkspawnspeakspearspecsspeedspellspendspentspermspicespicyspiesspikespillspinespinsspitesplitspoilspokespoonsportspotssprayspreespurssquadsquatsquidstackstaffstagestainstakestalestalkstallstampstandstarestarkstarsstartstashstatestatsstayssteakstealsteamsteelsteepsteersteinstemsstepssternstickstiffstillstingstinkstintstockstokestolestonestoodstoolstopsstorestormstorystoutstovestrapstrawstraystripstuckstudystuffstumpstuntstylesuckssugarsuingsuitesuitssunnysupersurgesushiswampswarmswearsweatsweepsweetswellsweptswiftswineswingswipeswissswordsworeswornswungsyruptabletabootacostailstakentakestalestalkstallytangotankstapedtapestaskstastetastytaxedtaxestaxisteachteamstearsteaseteddyteensteethtellstempotendstenortensetenthtentstermsterraterryteslateststexastextsthankthefttheirthemetherethesethickthiefthighthingthinkthirdthornthosethreethrewthrowthugsthumbtickstidaltidestigertighttilestimedtimertimestiredtirestitantitletoasttodaytokentommytonedtonestonictoolstoothtopictorahtorchtorsototaltouchtoughtourstowedtoweltowertownstoxictracetracktracttradetrailtraintraittranstrapstrashtreadtreattreestrendtrialtribetricktriedtriestripstrolltrooptrouttrucetrucktrulytrumptrunktrusttruthtubestummytumortunedtunesturboturksturnstutortwaintweettwicetwinstwisttyingtypedtypestyresultrauncleunderunfitunionuniteunitsunityuntilupperupseturbanurgedurgesurineusageusersusherusingusualuttervaguevalidvaluevalvevaporvaultveganveinsvenomvenueverbsvergeversevibesvicarvideoviewsvillavinesvinylviolaviralvirusvisasvisitvistavitalvividvocalvodkavoguevoicevomitvotedvotervotesvowedwagerwageswagonwaistwaitswakeswaleswalkswallswallywaltzwantswardswarnswastewatchwaterwattswavedwaveswearswearyweaveweberwedgeweedsweeksweighweirdwelchwellswelshwhackwhalewharfwhatswheatwheelwherewhichwhilewhitewholewhorewhosewiderwidowwidthwiganwillswillywindswindywineswingswipedwipeswiredwireswiserwitchwittywiveswokenwomanwomenwoodswoodywordsworksworldwormsworryworseworstworthwouldwoundwovenwrapswrathwreckwristwritewrongwroteyachtyahooyardsyearsyeastyellsyieldyikesyoungyoursyouthyummyzebrazones