4-Letter Words Starting With C
230 4-letter words start with the letter C, including come, city, care, case. Every word below is valid in Scrabble-style word games.
Highest scoring
- chez18
- cozy18
- czar15
- caky13
- calx13
- coax13
- coxa13
- crux13
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list230
cabscacacadecadicadscafecaffcagecagycaidcaincakecakycalfcalkcallcalmcalocalxcamecampcamscanecanscantcapecaphcapocapscarbcardcarecarkcarlcarncarpcarrcarscartcasacasecashcaskcastcatecatscaulcavecavycawscayscecacedecediceesceilcellcelsceltcentcepecepscerecerocesscetechadchamchaochapcharchatchawchaychefchewchezchiachicchidchinchipchischitchonchopchowchubchugchumciaocinecioncirecistcitecitycladclagclamclanclapclawclayclefclewclipclodclogclonclopclotcloyclubcluecoalcoatcoaxcobbcobscocacockcococodacodecodscoedcoffcoftcogscohocoifcoilcoincoircokecolacoldcolecolscoltcolycomacombcomecompconeconiconkconnconsconycoofcookcoolcooncoopcooscootcopecopscopycordcorecorfcorkcormcorncorycoshcosscostcosycotecotscoupcovecowlcowscowycoxacoyscozycrabcragcramcrapcrawcrewcribcriscroccropcrowcrudcruscruxcubecubscudscuedcuescuffcuifcukecullculmcultcuntcupscurbcurdcurecurfcurlcurncurrcurscurtcuskcuspcusscutecutscwmscyancymacymecystczar