10-Letter Words Starting With F
752 10-letter words start with the letter F, including foundation, facilities, frequently, friendship. Every word below is valid in Scrabble-style word games.
Highest scoring
- frizziness31
- frizzliest31
- freezingly26
- frenziedly26
- friezelike26
- factorized25
- fancyworks25
- feminizing25
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list752
fabricantsfabricatedfabricatesfabricatorfabulisticfabulouslyfaceclothsfaceplatesfacilenessfacilitatefacilitiesfacsimilesfactiouslyfactitiousfactorablefactoragesfactorialsfactorizedfactorizesfactorshipfactualismfactualistfactualityfaggotingsfaggotriesfairgroundfairleaderfairnessesfairylandsfaithfullyfalconriesfaldstoolsfallaciousfallfishesfallownessfalsehoodsfalseworksfalsifiersfalsifyingfamiliarlyfamilisticfamishmentfamousnessfanaticismfanaticizefancifullyfancifyingfancyworksfanfoldingfantasisedfantasisesfantasistsfantasizedfantasizerfantasizesfantasticofantasticsfantasyingfantoccinifaradisingfaradizingfarandolesfarcicallyfarewelledfarmerettefarmhousesfarmsteadsfarmworkerfarrieriesfarsightedfasciationfascicularfasciculesfasciculusfascinatedfascinatesfascinatorfashionersfashioningfastballerfasteningsfastidiousfastigiatefastnessesfatalisticfatalitiesfatherhoodfatherlandfatherlessfatherlikefathomablefathomlessfatshederafaultinessfavoritismfearfullerfearlesslyfearsomelyfeatherbedfeatherierfeatheringfeaturettefebrifugesfecklesslyfeculencesfecundatedfecundatesfederaciesfederalesefederalismfederalistfederalizefederatingfederationfederativefeeblenessfeedstocksfeedstuffsfeistinessfelicitatefelicitiesfelicitousfelinitiesfellationsfellmongerfellnessesfellowshipfemalenessfeminaciesfemininelyfemininityfeminisingfeministicfeminitiesfeminizingfenderlessfenestratefenugreeksfeoffmentsferacitiesferetoriesfermentersfermentingfermentorsferocitiesferredoxinferrellingferretingsferrocenesferrotypesferryboatsfertilizedfertilizerfertilizesfervenciesfervidnessfescenninefestinatedfestinatesfestooneryfestooningfetchinglyfetichismsfetishismsfetishistsfetologiesfetologistfetoscopesfettuccinefettuccinifeudalismsfeudalistsfeudalizedfeudalizesfeuilletonfeverishlyfeverwortsfianchettifianchettofiberboardfiberfillsfiberglassfiberizingfiberscopefibreboardfibrefillsfibreglassfibrillatefibrinogenfibrinoidsfibroblastfibrositesfibrositisficklenessfictioneerfictionistfictionizefictitiousfiddlebackfiddleheadfidelitiesfiduciallyfieldfaresfieldpiecefieldstonefieldstripfieldworksfiendishlyfiercenessfifteenthsfigurationfigurativefigureheadfilariasesfilariasisfilefishesfiliationsfilibusterfilmicallyfilmmakersfilmmakingfilmsetterfilmstripsfilterablefilthinessfiltratingfiltrationfimbriatedfinalisingfinalitiesfinalizingfinanciersfinancingsfinenessesfingerholdfingeringsfingerlikefingerlingfingernailfingerpickfingerpostfingertipsfinickiestfinitenessfinnickierfireballerfirebombedfirebrandsfirebreaksfirebricksfiredrakesfirefangedfirefightsfireguardsfirehousesfirelightsfireplacedfireplacesfirepowersfireproofsfirestonesfirestormsfirethornsfirewatersfirmamentsfirmnessesfirstbornsfirstlingsfisherfolkfishmongerfishplatesfishtailedfissioningfistfightsfisticuffsfitfulnessflabbinessflabellateflaccidityflackeriesflagellantflagellateflagellinsflagellumsflageoletsflagginglyflagitiousflagrancesflagrantlyflagstaffsflagstavesflagsticksflagstonesflamboyantflameproofflamingoesflammablesflannelingflannelledflapdoodleflashbacksflashboardflashbulbsflashcardsflashcubesflashinessflashlampsflashlightflashoversflashtubesflatfishesflatfootedflatlanderflatnessesflattenersflatteningflatterersflatteriesflatteringflatulenceflatulencyflatwashesflauntiestflavanonesflavonoidsflavoringsflavoristsflavorlessflavorsomeflavouringflawlesslyfleahopperflechettesfledglingsfleeringlyfleetinglyflemishingfleshinessfleshliestfleshmentsfletchingsflexitimesflichteredflickeringflightiestflightlessflimsinessflintinessflintlocksflippantlyflirtationflitteringfloatationfloatplaneflocculantflocculateflocculentfloodgatesfloodlightfloodplainfloodwaterfloorboardfloorclothflophousesfloppinessflorescentfloriationfloribundafloridnessflorigenicflorilegiaflotationsflounciestflouncingsflounderedflourishedflourisherflourishesflowchartsfloweragesflowerettefloweriestflowerlessflowerlikeflowerpotsflowmetersflowstonesfluctuatedfluctuatesfluffinessflugelhornfluidisingfluiditiesfluidizersfluidizingflummeriesflummoxingfluorescedfluorescerfluorescesfluoridatefluorinatefluorsparsflusteringflutterersflutteringfluviatileflyblowingflybridgesflycatcherflyspeckedflyswatterflyweightsfoamflowerfocalisingfocalizingfoliaceousfoliationsfolklorishfolkloristfolksinessfolksingerfollicularfollowingsfondnessesfontanellefoodstuffsfoolfishesfoolishestfootballerfootboardsfootbridgefootclothsfootfaultsfootlesslyfootlightsfootlockerfootnotingfootprintsfootstonesfootstoolsforaminousforbearersforbearingforbiddersforbiddingforcefullyforcemeatsforearmingforebodersforebodiesforebodingforebrainsforecaddieforecastedforecasterforecastleforechecksforeclosedforeclosesforecourtsforedatingforedoomedforefatherforefendedforefingerforefrontsforegatherforegroundforehandedforehoovesforeignersforeignismforejudgedforejudgesforeladiesforelockedforemotherforeordainforepassedforerunnerforeseeingforeshadowforeshanksforesheetsforeshocksforeshoresforeshowedforesightsforespeaksforespokenforestagesforestallsforestlandforestriesforeswearsforetastedforetastesforetellerforetokensforetopmanforetopmenforewarnedforfeitersforfeitingforfeitureforfendingforgathersforgettersforgettingforgivableforgivablyforjudgingforkliftedforlornestformalisedformalisesformalismsformalistsformalizedformalizerformalizesformalnessformamidesformationsformativesformattersformattingformidableformidablyformlesslyformulatedformulatesformulatorformulizedformulizesfornicatedfornicatesfornicatorforsythiasfortalicesfortepianoforthrightfortifiersfortifyingfortissimifortissimofortitudesfortnightsfortressedfortressesfortuitiesfortuitousforwardersforwardestforwardingfossickersfossickingfossilisedfossilisesfossilizedfossilizesfosteragesfosterlingfoulbroodsfoulnessesfoundationfounderingfoundlingsfountainedfourplexesfourragerefoursquarefourteenerfourteenthfoxhuntersfoxhuntingfoxinessesfoxtrottedfozinessesfractionalfractionedfracturingfragmentalfragmentedfragrancesfragrantlyframbesiasframboisesframeshiftframeworksfranchisedfranchiseefranchiserfranchisesfranchisorfrancolinsfrangipanefrangipanifrankfurtsfraternityfraternizefratricidefraudulentfraughtingfraxinellafreakinessfreakishlyfreckliestfreebasersfreebasingfreeboardsfreebootedfreebooterfreedwomanfreedwomenfreehandedfreeholderfreelancedfreelancerfreelancesfreeloadedfreeloaderfreemartinfreenessesfreestonesfreestylerfreestylesfreewheelsfreezinglyfreightagefreightersfreightingfremitusesfrenziedlyfrequencesfrequentedfrequenterfrequentlyfreshenersfresheningfreshwaterfriabilityfricandeaufricandoesfricasseedfricasseesfricativesfrictionalfriedcakesfriendlessfriendlierfriendliesfriendlilyfriendshipfriezelikefrightenedfrigidnessfrigorificfripperiesfriskinessfritillaryfritterersfritteringfrivollersfrivollingfrizzinessfrizzliestfrogfishesfroghopperfrolickingfrolicsomefromentiesfrontalityfrontcourtfrontwardsfrostbitesfrostinessfrostworksfrothinessfrowninglyfrowstiestfrozennessfructifiedfructifiesfrugivoresfruitarianfruitcakesfruiterersfruitfullyfruitinessfruitwoodsfrumentiesfrustratedfrustratesfrutescentfugacitiesfugitivelyfulfillersfulfillingfulguratedfulguratesfulguritesfuliginousfullerenesfullnessesfulminatedfulminatesfumatoriesfumblinglyfumigatingfumigationfumigatorsfumitoriesfunctionalfunctionedfundamentsfundraiserfunereallyfungicidalfungicidesfunicularsfunnelformfunnellingfuranosidefurbearersfurbelowedfurbishersfurbishingfurcationsfurloughedfurmentiesfurnishersfurnishingfurnituresfurosemidefurrieriesfurtherersfurtheringfusibilityfusilladesfusionistsfussbudgetfustigatedfustigatesfusulinidsfutilenessfutilitiesfuturelessfuturisticfuturitiesfuturology