10-Letter Words Ending in Y
1,424 10-letter words end in Y, including university, especially, technology, completely. All are playable in Scrabble-style games and useful for Wordle endings.
Highest scoring
- dizzyingly36
- blizzardly34
- puzzlingly34
- dazzlingly33
- zygomorphy33
- complexify29
- hokeypokey29
- xylography29
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list1,424
aberrantlyablativelyabnormallyabominablyabortivelyabrasivelyabsolutelyabsorbancyabsorbencyabstractlyabstruselyabstrusityabundantlyacceptablyacceptedlyaccessiblyaccidentlyaccuratelyaccursedlyaccusatoryaccusinglyacidimetryacromegalyactabilityactionablyadaptivelyadaptivityadditivelyadditivityadequatelyadherentlyadhesivelyadjacentlyadjuratoryadmiringlyadmittedlyadmonitoryadoptivelyadvertencyaffabilityaffectedlyafferentlyaffluentlyaffordablyagitatedlyalarminglyalimentaryalkalinityalluringlyallusivelyalogicallyalveolarlyambulatoryamendatoryamiabilityanemicallyanemometryaneuploidyangelologyangularityanimatedlyanisotropyannoyinglyanodicallyanteriorlyantifamilyantipiracyapothecaryapparentlyappositelyapprovablyaquilinityarboreallyarcheologyarcticallyarmoriallyarrogantlyarteriallyarticulacyascendancyascendencyasexualityassertedlyastrometryasynchronyatomicallyatypicallyaudibilityaudiometryauditorilyautecologyautographyautotrophyautumnallyauxotrophyaversivelyaxenicallybackwardlybackwoodsybafflinglybalneologybankruptcybaptisterybardolatrybathymetrybecominglybelievablybenignancybestialitybewitcherybiannuallybiblicallybibliologybibliopegybibulouslybienniallybifaciallybigamouslybimanuallybimodalitybinaurallybinomiallybipedalitybipolaritybisexuallyblackberryblamefullyblimpishlyblindinglyblissfullyblizzardlyblurringlyblushinglyboastfullybootlesslybouncinglybreaksawaybrilliancybroodinglybuffoonerybumblinglybunchberrybunglinglybustlinglycacographycanonicitycanorouslycapabilitycapitularycaptiouslycardinallycardiologycarelesslycarpellarycastratorycatchpennycathodallycausticitycautionarycautiouslycavalierlycentralitycentricitycerebrallychalcedonychangeablychaplaincycharacterychardonnaycharitablycharminglychartularychatoyancycheapishlycheerfullychemicallychildishlychillinglychinaberrychiromancychlorinitychocolateychokeberrychronicitychronologychurlishlycircularlyclankinglyclannishlyclearstoryclerestoryclericallyclinicallycliquishlycloudberryclownishlycockeyedlycocksurelycodicologycoequalitycoercivelycoercivitycognizablycoherentlycohesivelycohomologycoloniallycolorfullycolossallycomicalitycommanderycommentarycommissarycommonaltycommunallycomparablycompatiblycompetencycompletelycomplexifycomplexitycompliancycomplicacycomplicitycomposedlycompulsoryconcededlyconchologyconcinnityconclusoryconcretelyconfocallyconformityconfusedlycongruencyconjointlyconjugallyconsistoryconsonancyconspiracyconstantlyconsumedlycontiguitycontinuitycontrarilycontritelyconverselycoprophagycopulatorycoralberrycordialitycorporallycorporeitycorpulencycorticallycosmicallycostlesslycoulometrycountercrycounterspycovalentlycovetinglycovetouslycraniologycraniotomycrashinglycreativelycreativitycreaturelycreditablycrescivelycriminallycriticallycrushinglycryptologyculinarilyculturallycumbrouslycurabilitycurativelycutabilitycyclicallycystoscopydamaginglydandyishlydauntinglydazzlinglydebaucherydebonairlydecadentlydecisivelydeclassifydecorouslydecrepitlydedicatorydefamatorydefensiblydeficiencydefinitelydegeneracydegradedlydehumidifydejectedlydelectablydelicatelydelusivelydementedlydemographydemonologydendrologydeontologydependablydependencydepilatorydeplorablydepositarydepositorydepravedlyderidinglyderisivelyderogatorydeservedlydesignedlydesirouslydesolatelydespicablydetachablydetachedlydetailedlydetergencydetestablydevilishlydiagonallydictionarydifficultydigitatelydilatorilydiligentlydillydallydisabilitydiscreetlydiscretelydiseconomydisharmonydishonestydisloyallydisloyaltydisorderlydispensarydisputablydisqualifydisquietlydissatisfydistillerydistinctlydisutilitydivergencydivinatorydivisivelydizzyinglydolorouslydominantlydoubtfullydoubtinglydownwardlydragginglydramaturgydrawlinglydreadfullydreamfullydriftinglydroopinglydrudginglydrysalterydurabilitydwarfishlydyadicallydyeabilityebulliencyeffeminacyefferentlyefficacityefficiencyeffronteryeffusivelyelasticityelderberryelectivelyelementaryeloquentlyemblazonryembroideryembryogenyembryologyemeticallyemissivityendemicityendomorphyendothermyenduringlyengaginglyenormouslyenticinglyentomologyenzymologyepeirogenyepiscopacyepisiotomyepisomallyepistolaryequabilityequanimityerectilityergodicityeroticallyeruptivelyescalatoryescapologyespeciallyesurientlyethereallyethicalityethnicallyeventfullyeventuallyexactinglyexcellencyexcitatoryexcitinglyexcusatoryexhibitoryexiguouslyexobiologyexoticallyexpectablyexpectancyexpectedlyexpediencyexpiratoryexplicablyexplicitlyexpositoryexpresswayextendedlyexteriorlyexternallyexultantlyexultinglyfabulouslyfactiouslyfactualityfaithfullyfamiliarlyfancifullyfarcicallyfearlesslyfearsomelyfecklesslyfemininelyfemininityfestooneryfetchinglyfeverishlyfiduciallyfiendishlyfilmicallyflaccidityflagginglyflagrantlyflatulencyflawlesslyfleeringlyfleetinglyflippantlyfootlesslyforcefullyforgivablyformidablyformlesslyfragrantlyfraternityfreakishlyfreezinglyfrenziedlyfrequentlyfriabilityfriendlilyfritillaryfrontalityfrowninglyfruitfullyfugitivelyfumblinglyfunereallyfusibilityfuturologygadzookerygamesomelygastronomygendarmerygeneralitygenerositygenerouslygerminallygesturallyghastfullyghoulishlygigglinglyglaciologygladsomelyglancinglygloatinglygloriouslygoniometrygooseberrygorgeouslygothicallygovernessygracefullygraciouslygranddaddygraphologygraspinglygratefullygravimetrygrievouslygrindinglygrinninglygrippinglygrowlinglygrudginglygruelinglygruesomelyguilefullygynecologyhabituallyhandsomelyharmlesslyhauntinglyhecticallyheedlesslyheliacallyheliolatryhelplesslyhematologyhereditaryheroicallyhesitantlyheterodoxyheterogamyheterogenyheterogonyheteronomyhexaploidyhokeypokeyholographyhomeopathyhonorarilyhootenannyhopelesslyhormonallyhospitablyhousewifeyhumblinglyhumbuggeryhumorouslyhydromancyhydropathyhymeneallyiconicallyiconolatryideographyignobilityignorantlyillativelyillaudablyillegalityilliteracyillusivelyillusorilyimaginablyimbecilityimmaculacyimmanentlyimmaturelyimmaturityimminentlyimmobilityimmoderacyimmodestlyimmoralityimmortallyimmunologyimpalpablyimpartiblyimpassablyimpassiblyimpeccablyimperiallyimplacablyimplicitlyimpolitelyimportancyimposinglyimpossiblyimpotentlyimprobablyimproperlyimpudentlyimpudicityinaccuracyinactivelyinactivityinadequacyinarguablyincapacityincendiaryincessancyinchoatelyincipiencyincisivelyincivilityinclemencyincrediblyincubatoryincumbencyindecentlyindelicacyindicatoryindirectlyindocilityindolentlyinefficacyinequalityinertiallyinevitablyinexorablyinexpertlyinexpiablyinfalliblyinfamouslyinfelicityinferiorlyinfernallyinfidelityinfinitelyinflexiblyinformallyinformedlyinherentlyinhibitoryinhumanelyinhumanityinimicallyinimitablyinitiatoryinnocentlyinnovatoryinnumeracyinsanitaryinsatiablyinsecurelyinsecurityinsensiblyinsipidityinsistencyinsobrietyinsociablyinsolentlyinsolvablyinsolvencyinsularityinsurgencyintangiblyintegrallyintendedlyinteriorlyintermarryinternallyinterpartyintimatelyintrepidlyinundatoryinvalidityinvaluablyinvariablyinvasivelyinveteracyinvinciblyinviolablyinvitatoryinvitinglyinvocatoryinvolvedlyirenicallyironicallyitinerancyjackasseryjocularityjubilantlyjudicatoryjudiciallyjuvenilitykeratotomykindlesslykymographylaboratorylamentablylamentedlylampoonerylaparotomylaughinglylectionarylegibilitylegitimacylenitivelylevorotarylexicalitylexicologyliberalitylifelesslylikabilitylimitinglylistlesslyliteralityliterarilyliteratelylivabilitylocomotoryloganberrylogicalitylonesomelylongsomelylopsidedlylovabilitylovelesslyluculentlylukewarmlyluminosityluminouslylumpectomylusciouslylustrouslymagistracymalacologymalapertlymalignancymammillarymanageablymaniacallymanifestlymanifoldlymarginallymastectomymateriallymaternallymatriarchymeasurablymeasuredlymedievallymediocritymelancholymemoriallymenacinglymendicancymercifullymesomorphymetagalaxymetallurgymetastablymetricallymicroscopymiddlinglymidnightlymilitantlymilitarilymillihenrymindlesslymineralogyminstrelsymirthfullymiscellanymissiologymissionarymistakenlymitigatorymoderatelymodularitymodulatorymonaurallymonetarilymorphologymosaicallymosquitoeymournfullymourninglymovabilitymovelesslymuliebritymultipartymultistorymuscularlymusicalitymusicianlymusicologymutabilitymutinouslymyelopathymyopicallymysticallymythicallynamelesslynaprapathynarcolepsynationallynauseouslynauticallynebulositynebulouslynecromancyneedlesslynegativelynegativitynegligiblyneighborlynematologyneonatallynephrologyneuropathyneutralitynewsweeklynewsworthynigglinglynomographynoncountrynonfacultynonfluencynonlibrarynonutilitynotabilitynotariallynoteworthynoticeablynotionallynumerologynumerouslynuptialityobduratelyobedientlyobeisantlyobligatelyobligatoryobliginglyobservablyobsoletelyoceanologyochlocracyofficiallyoligophagyoligopsonyoppositelyoptativelyoptimalityoptionallyoracularlyordinarilyorganicityorganologyorientallyoriginallyorismologyorotundityorphicallyorthodoxlyosculatoryosmolalityosmolarityostensiblyosteopathyoutdatedlyoutrightlyovariotomyovermightyoversimplyoversupplypainlesslypalatiallypalynologypapyrologypardonablyparentallypartialitypartisanlypassagewaypastorallypaternallypatriarchypeacefullypeculiarlypeerlesslypellucidlypenitentlypensionaryperdurablyperemptoryperilouslypermanencypernicketyperpetuityperplexitypersonallypersonaltypertinencyperverselyperversitypetulantlyphaticallyphilosophyphlebologyphlebotomyphonicallyphoticallyphotometryphrenologyphylacteryphyllotaxyphysicallyphysiologypickaninnypiercinglypigmentarypinchpennypitilesslyplangentlyplanlesslyplasmogamyplasticitypleadinglypleasantlypleasantrypleasinglyplebeianlypleiotropypliabilityploddinglyplutocracypoeticallypoignantlypolychromypolyploidypopularitypopulouslypositivelypositivitypossessorypostulancypotabilitypowerfullyprankishlypraxeologyprebendaryprecedencypreceptoryprecertifypreciositypreciouslyprecursorypreemptorypreferablypregnantlyprehistorypreholidayprenatallypreparedlyprepenselyprepotencypreprimaryprepubertyprequalifypresbyterypresidencypresidiarypresignifyprespecifypressinglypresumablypresumedlypresurgerypreviouslypridefullypriggishlyprimevallypristinelyproclivityproctologyprodigallyprofitablyprofligacyprofoundlyprofunditypromissorypromontorypropensityprosperityprotectoryproximallyprurientlypsephologypsychiatrypsychologypublicallypunctuallypunitivelypurblindlyputativelypuzzlinglyqualmishlyquaternaryquaternityradiometryramblinglyrationallyrattlinglyravenouslyreactivelyreactivityreasonablyreassemblyrecklesslyreclassifyrecumbencyredeliveryredemptoryredolentlyredundancyrefractoryregeneracyregionallyregularityregulatoryreidentifyrelativelyrelativityrelevantlyrelievedlyreluctancyremarkablyremediallyremissiblyrenographyrepeatedlyrepellencyreportedlyrepositoryrepugnancyrescissoryreservedlyresiduallyresignedlyresiliencyresolidifyresolutelyresonantlyresponsoryrestlesslyreticentlyretiringlyrevelatoryreverentlyreversiblyrhinoscopyrightfullyrigorouslyrisibilityrivetinglyroadworthyrockabillyrotativelyrowanberryrubricallyruminantlyrusticallyruthlesslysaccharifysagittallysalabilitysalutarilysalutatorysanctimonysandpaperysanguinarysanguinelysanguinitysanitarilyscabrouslyscathinglyscenicallyschizogonyscornfullyscowlinglyscratchilyscreenplayscurrilityseamlesslyseasonablyseasonallysecludedlysecularitysedulouslysegmentaryseismicityseismologyselenologyselflesslysemeiologysemicolonyseminuditysemiweeklysemiyearlysensualitysensuositysensuouslysentientlyseparatelyserigraphysewabilityshamefullysheepberrysheepishlyshockinglyshrewishlyshrievaltysibilantlysimilaritysimplicitysingularlysinisterlyskeletallyskillfullyskittishlyslantinglyslashinglyslatternlyslavocracyslothfullysluggardlysluggishlysluttishlysmashinglysnappishlysneakinglysniffishlysnobbishlysocietallysociometrysolidaritysolitarilysolubilitysomatologysonglesslysonographysonorouslysoothinglysoullesslysoundinglyspaciouslyspasticityspatialityspecialityspeciosityspeciouslyspectrallyspecularlyspeleologysphericityspinsterlyspiritedlyspirometryspitefullysplendidlysportfullysportinglysportivelyspotlesslyspuriouslysquarishlysquirarchysquirrellystagnantlystalwartlystandardlystaticallystationarystationerystealthilystepfamilystereologystereotypystericallysterlinglystiflinglystinginglystinkinglystirringlystraightlystrathspeystrawberrystridentlystrikinglystringencystubbornlystudiouslystunninglysubacutelysubeconomysubjacencysubpotencysubsidiarysubsocietysubtenancysubtotallysubvarietysubvocallysuccinctlysufferablysugarberrysuicidallysuperalloysuperheavysuperiorlysupernallysuppletorysupposablysupposedlysurgicallysuspensorysuzeraintysweepinglysweetishlyswimminglyswinginglyswirlinglyswishinglyswooninglysycophancysyndactylysynecologysynonymitytacticallytactlesslytastefullytauntinglytechnologyteetotallytelegraphytemporallytemptinglytenabilitytenuriallyteratologyterminablyterminallytexturallythankfullytheticallythievishlythinkinglythixotropythoroughlythoughtwaythreepennythrivinglythroughwaythymectomyticklishlytigerishlytimelesslytimorouslytinglinglytirelesslytiresomelytoilsomelytolerantlytomfoolerytomographytonelesslytopicalitytoploftilytopographytoroidallytortiouslytortuositytortuouslytouchinglytoweringlytoxicologytragicallytrajectorytranquillytransiencytransitorytrenchancytrichologytrichotomytrickishlytrierarchytrigonallytrihydroxytrimonthlytriplicitytrippinglytristfullytrivialitytropicallytruculencytrustfullytrustinglytruthfullytuberositytumultuarytunabilitytunelesslyturbulencytypicalitytypographyulteriorlyultimatelyultraheavyunabatedlyunarguablyunbearablyunbeatablyuncandidlyunchastelyunchastityunchurchlyuncommonlyunctuouslyundeniablyunderbellyunderstoryunderstudyundulatoryunendinglyunerringlyunfadinglyunfiliallyunfriendlyungimmickyuniformityuniversityunivocallyunlawfullyunliteraryunmannerlyunmilitaryunmoralityunsanitaryunshakablyunsociablyunsociallyunsteadilyunsuitablyuntiringlyuntowardlyunwieldilyunwontedlyunworthilyupholsteryurbanologyusuriouslyuxoriouslyvalorouslyvaporouslyvaricosityvaultinglyvauntinglyvehementlyvengefullyvenographyvenomouslyverticallyveterinaryviewlesslyvigilantlyvigorouslyviperouslyvirginallyvirtualityvirtuosityvirtuouslyvirulentlyviscerallyviscometryviscountcyvisibilityvisionallyvitrectomyviviparityvocabularyvocativelyvolatilityvolubilityvoluptuaryvorticallyvulnerablywastefullywatchfullywavelesslywaveringlywearifullywindlesslywomanishlywondrouslywordlesslywrathfullywretchedlywrongfullyxerographyxylographyyearninglyyoungberryyouthfullyzygomorphy