Skip to content

comprise

/kəmˈpɹaɪz/verb2 syllables

Comprise means: form or compose.

Synonyms for comprise12

verb, as in form or compose

constitute, represent, make up, be

verb, as in include or contain; have as a component

incorporate, contain

verb, as in be composed of

consist

also used for comprise

subsume, include, embrace, comprehend, form

Includes material from Wiktionary, CC BY-SA 4.0.

What does comprise mean?3

verb

1

form or compose“This money is my only income”

2

include or contain; have as a component“A totally new idea is comprised in this paper”

3

be composed of“The land he conquered comprised several provinces”

Definitions from the Open English WordNet, CC BY 4.0.

What rhymes with comprise?43

Show 40 near rhymes
ibymyliketimerightwhylifewhilefindhighmightnighttimeslivewhitesidetrylinefivekindmindguynicelightbuychildbehindquitesometimestypeoutsidefightfinepricewifesitediedinsiderights

All 43 rhymes for comprise, grouped by syllable

Comprise in a sentence

  • The meaning of an average man's life comprises three things: eating, drinking, and fucking.Ooneykcall
  • This sentence comprises of exactly eighty-seven characters, and so do its translations.espamatics
  • Food is comprised of protein, carbohydrates, and fats.Eccles17
  • The study of theology is comprised of philosophy, history and anthropology.issadouba
  • Workers in these factories comprise a large percentage of immigrants.karloelkebekio
  • The pisiform bone is one of eight tiny bones that comprise the wrist.DanielDaniel
  • This series of books comprises forty-eight volumes.Eccles17
  • A week comprises a hundred and sixty-eight hours.sundown

Sentences from Tatoeba, CC BY 2.0 FR, credited to their authors.

Forms of comprise

as a verb

past tense
comprised
present participle
comprising
third-person singular
comprises
past participle
comprised